Gibby Car Wash
Gibby Car WashCar Wash BlogsCar Wash Near Me
ArkansasIllinoisIndianaKansasKentuckyMissouriOklahomaTennessee
Gibby Car WashCar Wash Near MeKansasLeavenworth CountyLansingCar Wash in West Eisenhower RoadClub Car Wash
Club Car Wash ico

Club Car Wash

Car wash ★4.0

380 W Eisenhower Rd, Lansing, KS 66043, USA

4.0
My niece came by the carwash earlier yesterday. The attendant operating the power washer noticed he was taking paint off the bumper as he was power washing the bumper. He pointed at the camera and continued to keep power washing. He told my niece what had happened. She asked why you didn't stop. He said it's on the camera. She filed a claim. The one in charge tried to download play the issue and admitted they have the video. I told her to ask when would be a good time to review the video together. There response is we can not give you a copy of the video. No one asked for a copy of the video. Only to sit down and review it together. They continued to down play this and avoid taking any responsibility for there action. - Mike Lands Lands
Club Car Wash Overview Photos Intro Services Detail Location Reviews

Club Car Wash Photos

Club Car Wash Picture 1Club Car Wash Picture 2Club Car Wash Picture 3Club Car Wash Picture 4Club Car Wash Picture 5Club Car Wash Picture 6Club Car Wash Picture 7Club Car Wash Picture 8Club Car Wash Picture 9Club Car Wash Picture 10

Club Car Wash Introduce

Welcome, drivers of Kansas! Keeping your vehicle looking its best is a priority for many, especially when facing the varied weather conditions across our state. In Lansing, finding a car wash that offers both efficiency and a high-quality clean is essential. Club Car Wash, located conveniently on W Eisenhower Road, is a prominent name in the car care industry, known for its modern facilities and comprehensive wash options. This article will provide an in-depth look at what Club Car Wash in Lansing offers, including its services, unique features, and important considerations for local users.

Club Car Wash operates on a model that emphasizes speed, technology, and customer convenience. They strive to deliver a consistent, thorough wash, aiming to get your vehicle sparkling clean in minutes. Whether you’re a daily commuter, a family with active kids, or simply someone who appreciates a pristine car, Club Car Wash in Lansing is designed to meet a wide array of vehicle cleaning needs. They offer various wash packages and an attractive unlimited wash club, making it a popular choice for many Kansans seeking regular car maintenance.

Location and Accessibility

Club Car Wash is strategically located at 380 W Eisenhower Rd, Lansing, KS 66043, USA. This address places it on a well-known thoroughfare in Lansing, ensuring excellent visibility and straightforward access for residents and those commuting through the area. W Eisenhower Road is a key route, making the car wash a convenient stop for quick services, whether you're running errands, on your way to or from work, or simply deciding your car needs a refresh.

The accessibility of this location is a significant advantage for local users in Lansing and the surrounding communities. Its proximity to residential areas and commercial hubs means that drivers can easily integrate a car wash into their daily routines without needing to travel far. Club Car Wash facilities are typically designed for efficient traffic flow, even during peak hours, ensuring a smooth and quick experience from entry to exit, which is a considerable benefit for busy Kansas drivers.

Services Offered

Club Car Wash offers a range of express exterior car wash packages, designed to provide varying levels of cleaning and protection for your vehicle. They also focus on providing convenient amenities for interior cleaning.

  • Express Car Wash Packages: Club Car Wash offers several tiers of automated car washes, each building upon the previous one with additional features. Common package names and their likely inclusions are:
    • Express Wash: Typically includes a soft foam wash, fresh water rinse, and high velocity dry. This is ideal for quick cleanups.
    • Deluxe/Works Wash: Often adds features like wheel & tire cleaner, underbody rust inhibitor, and triple foam polish.
    • Premium/Diamond/Elite Wash: The highest tier, usually featuring hot carnauba wax, ceramic shield protection, tire shine, and spot-free rinse. Some locations may also offer specialized treatments like Ceramic Sea Gloss™ or Graph-X4™.
  • Unlimited Wash Club® Membership: This is a core offering, allowing members to wash their vehicles as often as they want (typically up to twice per day) for a single monthly fee. Memberships are contract-free and can often be managed through an app or online portal. Various tiers of unlimited plans correspond to the single wash packages.
  • PayPerWash Options: For less frequent users, individual washes can be purchased directly at the pay station.
  • Complimentary Vacuums: All Club Car Wash locations typically offer free, powerful vacuum stations for customers to clean the interior of their vehicles after an exterior wash.
  • Self-Grab Towels: Many locations provide clean towels for customer use, allowing for quick wipe-downs or drying.
  • Interior Cleaning Solutions/Products: Some Club Car Wash locations provide complimentary cleaning solutions and cleaning cloths for interior surfaces like windows, dashboards, and upholstery, available with the purchase of a single wash or membership.
  • Bug Prep Station/Automated Bug Spray: Some locations feature a bug prep station or automated bug spray to help remove stubborn bug residue from the front of your vehicle.
Features / Highlights

Club Car Wash aims to provide a premium and convenient car wash experience through several notable features:

  • Modern Equipment: They utilize high-tech soft-cloth automated tunnels designed for efficient and effective cleaning, aiming for a clean, dry, and shiny finish.
  • Speed and Efficiency: The express model ensures a quick wash process, allowing customers to get in and out quickly, which is highly valued by busy drivers.
  • Unlimited Wash Club®: This membership program is a major draw, offering significant savings for frequent washers and the convenience of washing at any Club Car Wash location nationwide.
  • Free Amenities: The provision of free vacuums, and often free towels and interior cleaning solutions, significantly enhances the overall value and convenience, allowing customers to complete their car care in one stop.
  • Community Involvement: Club Car Wash often emphasizes its mission and values, which include supporting and fundraising in local communities. Some locations engage in partnerships and give back to local organizations.
  • Contactless Express Member Lane: For members, dedicated lanes often allow for seamless entry via a windshield tag, further speeding up the process.

However, it is crucial for potential customers to be aware of some concerns raised in customer reviews:

  • Customer Service and Damage Claims: There have been reports of issues with how damage claims are handled, with customers expressing frustration over the process, denial of responsibility, and difficulty in reviewing video evidence. This indicates that while incidents may be rare, the resolution process can be challenging for the customer.
  • Membership Cancellation and Refunds: Some customers have reported difficulties or lack of empathy when canceling memberships, especially in sensitive situations, and issues with receiving refunds for unused portions of service.
Contact Information

For more information about services, membership details, or to address concerns, you can contact Club Car Wash:

Address: 380 W Eisenhower Rd, Lansing, KS 66043, USA

Phone: (833) 416-9975

Mobile Phone: +1 833-416-9975

Typical Business Hours: (These may vary, always check the official website or call ahead for exact times)

  • Monday - Saturday: 7:00 AM - 8:00 PM
  • Sunday: 8:00 AM - 8:00 PM

It is advisable to check their official website or call the provided number for the most up-to-date information on operating hours, specific wash offerings, and membership terms.

Conclusion: Why this place is suitable for locals

For residents of Lansing, Kansas, and the surrounding areas, Club Car Wash at 380 W Eisenhower Rd stands as a highly accessible and feature-rich option for keeping vehicles clean. Its prime location on a major road ensures convenience for daily commutes and quick detours. The wide array of express wash packages, coupled with the highly beneficial Unlimited Wash Club® membership, offers significant value and flexibility for regular car care. The inclusion of free powerful vacuums and other interior cleaning amenities further enhances the overall appeal, making it a comprehensive solution for maintaining your vehicle's appearance.

While the majority of experiences are likely positive, potential customers should be aware of the occasional reported issues regarding damage claims and membership cancellations. However, for those seeking a fast, modern, and convenient car wash experience with the option for unlimited washes, Club Car Wash in Lansing remains a suitable and popular choice. Its commitment to advanced technology and customer-focused amenities positions it as a go-to spot for keeping your car sparkling clean in Kansas.

Club Car Wash Services

  • Car Wash

  • Auto detailing
  • Auto interior vacuuming
  • Car waxing
  • Polishing
  • Scratch removal
  • Vacuuming
  • Bug Prep
  • Car Mats
  • Car Wash Club
  • Ceramic X3
  • Express Car Wash
  • Floor Mat
  • Free Towels
  • Free Vacuums
  • Hot Wax
  • Interior Cleaning
  • Normal Car Wash
  • Premium Washes
  • Spot Free Rinse
  • Underbody Blast
  • Unlimited Club
  • Vehicle Washed
  • Water Spots
  • Wheel Blasters
  • Wheel Brightener

Club Car Wash Details

  • Amenities

  • Car vacuum
  • Free vacuums
  • Membership
  • Towels
  • Payments

  • Credit cards
  • Debit cards

Club Car Wash Location

Club Car Wash

380 W Eisenhower Rd, Lansing, KS 66043, USA

Club Car Wash Reviews

An average rating of ★4.5 from 346 user reviews.

vacuumstowelsvehiclediscountkidsmilitarymatswindshieldrefundtip

★ 5★ 4★ 3★ 2★ 1

More Car Wash Near Me

  • Classic Carwash SouthClassic Carwash South4.0 (311 reviews)

    900 Eisenhower Rd, Leavenworth, KS 66048, USA

  • Olympic-Car WashOlympic-Car Wash4.0 (380 reviews)

    3107 S 4th St, Leavenworth, KS 66048, USA

  • Cowboy Express Car WashCowboy Express Car Wash4.0 (69 reviews)

    501 Metropolitan Ave, Leavenworth, KS 66048, USA

  • Classic Carwash NorthClassic Carwash North4.0 (184 reviews)

    1225 Metropolitan Ave, Leavenworth, KS 66048, USA

  • PRO CAR WASH PLATTE CITYPRO CAR WASH PLATTE CITY4.0 (15 reviews)

    1303 Plaza Ct, Platte City, MO 64079, USA

  • GO Car WashGO Car Wash3.0 (99 reviews)

    2500 Running Horse Rd, Platte City, MO 64079, USA

  • Ward's Car WashWard's Car Wash3.0 (210 reviews)

    10215 Leavenworth Rd, Kansas City, KS 66109, USA

  • Tidal Wave Auto Spa | Car WashTidal Wave Auto Spa | Car Wash4.0 (331 reviews)

    10760 Parallel Pkwy, Kansas City, KS 66109, USA

  • GO Car WashGO Car Wash3.0 (359 reviews)

    9801 Troup Ave, Kansas City, KS 66109, USA

  • Porter Buggy BathPorter Buggy Bath3.0 (196 reviews)

    399 N 130th St, Bonner Springs, KS 66012, USA

  • GO Car WashGO Car Wash4.0 (214 reviews)

    13015 Commercial Dr, Bonner Springs, KS 66012, USA

  • GO Car WashGO Car Wash4.0 (389 reviews)

    8717 NW 63rd St, Parkville, MO 64152, USA

  • Categories

    Top Visited Sites

    Top Searches

    Trending Car Wash Blogs Posts