Club Car Wash Overview
Use this section to understand what information is available before you compare, call, or visit.
Welcome, drivers of Kansas! Keeping your vehicle looking its best is a priority for many, especially when facing the varied weather conditions across our state. In Lansing, finding a car wash that offers both efficiency and a high-quality clean is essential. Club Car Wash, located conveniently on W Eisenhower Road, is a prominent name in the car care industry, known for its modern facilities and comprehensive wash options. This article will provide an in-depth look at what Club Car Wash in Lansing offers, including its services, unique features, and important considerations for local users.
Club Car Wash operates on a model that emphasizes speed, technology, and customer convenience. They strive to deliver a consistent, thorough wash, aiming to get your vehicle sparkling clean in minutes. Whether you’re a daily commuter, a family with active kids, or simply someone who appreciates a pristine car, Club Car Wash in Lansing is designed to meet a wide array of vehicle cleaning needs. They offer various wash packages and an attractive unlimited wash club, making it a popular choice for many Kansans seeking regular car maintenance.
Club Car Wash is strategically located at 380 W Eisenhower Rd, Lansing, KS 66043, USA. This address places it on a well-known thoroughfare in Lansing, ensuring excellent visibility and straightforward access for residents and those commuting through the area. W Eisenhower Road is a key route, making the car wash a convenient stop for quick services, whether you're running errands, on your way to or from work, or simply deciding your car needs a refresh.
The accessibility of this location is a significant advantage for local users in Lansing and the surrounding communities. Its proximity to residential areas and commercial hubs means that drivers can easily integrate a car wash into their daily routines without needing to travel far. Club Car Wash facilities are typically designed for efficient traffic flow, even during peak hours, ensuring a smooth and quick experience from entry to exit, which is a considerable benefit for busy Kansas drivers.
Club Car Wash offers a range of express exterior car wash packages, designed to provide varying levels of cleaning and protection for your vehicle. They also focus on providing convenient amenities for interior cleaning.
- Express Car Wash Packages: Club Car Wash offers several tiers of automated car washes, each building upon the previous one with additional features. Common package names and their likely inclusions are:
- Express Wash: Typically includes a soft foam wash, fresh water rinse, and high velocity dry. This is ideal for quick cleanups.
- Deluxe/Works Wash: Often adds features like wheel & tire cleaner, underbody rust inhibitor, and triple foam polish.
- Premium/Diamond/Elite Wash: The highest tier, usually featuring hot carnauba wax, ceramic shield protection, tire shine, and spot-free rinse. Some locations may also offer specialized treatments like Ceramic Sea Gloss™ or Graph-X4™.
- Unlimited Wash Club® Membership: This is a core offering, allowing members to wash their vehicles as often as they want (typically up to twice per day) for a single monthly fee. Memberships are contract-free and can often be managed through an app or online portal. Various tiers of unlimited plans correspond to the single wash packages.
- PayPerWash Options: For less frequent users, individual washes can be purchased directly at the pay station.
- Complimentary Vacuums: All Club Car Wash locations typically offer free, powerful vacuum stations for customers to clean the interior of their vehicles after an exterior wash.
- Self-Grab Towels: Many locations provide clean towels for customer use, allowing for quick wipe-downs or drying.
- Interior Cleaning Solutions/Products: Some Club Car Wash locations provide complimentary cleaning solutions and cleaning cloths for interior surfaces like windows, dashboards, and upholstery, available with the purchase of a single wash or membership.
- Bug Prep Station/Automated Bug Spray: Some locations feature a bug prep station or automated bug spray to help remove stubborn bug residue from the front of your vehicle.
Club Car Wash aims to provide a premium and convenient car wash experience through several notable features:
- Modern Equipment: They utilize high-tech soft-cloth automated tunnels designed for efficient and effective cleaning, aiming for a clean, dry, and shiny finish.
- Speed and Efficiency: The express model ensures a quick wash process, allowing customers to get in and out quickly, which is highly valued by busy drivers.
- Unlimited Wash Club®: This membership program is a major draw, offering significant savings for frequent washers and the convenience of washing at any Club Car Wash location nationwide.
- Free Amenities: The provision of free vacuums, and often free towels and interior cleaning solutions, significantly enhances the overall value and convenience, allowing customers to complete their car care in one stop.
- Community Involvement: Club Car Wash often emphasizes its mission and values, which include supporting and fundraising in local communities. Some locations engage in partnerships and give back to local organizations.
- Contactless Express Member Lane: For members, dedicated lanes often allow for seamless entry via a windshield tag, further speeding up the process.
However, it is crucial for potential customers to be aware of some concerns raised in customer reviews:
- Customer Service and Damage Claims: There have been reports of issues with how damage claims are handled, with customers expressing frustration over the process, denial of responsibility, and difficulty in reviewing video evidence. This indicates that while incidents may be rare, the resolution process can be challenging for the customer.
- Membership Cancellation and Refunds: Some customers have reported difficulties or lack of empathy when canceling memberships, especially in sensitive situations, and issues with receiving refunds for unused portions of service.
For more information about services, membership details, or to address concerns, you can contact Club Car Wash:
Address: 380 W Eisenhower Rd, Lansing, KS 66043, USA
Phone: (833) 416-9975
Mobile Phone: +1 833-416-9975
Typical Business Hours: (These may vary, always check the official website or call ahead for exact times)
- Monday - Saturday: 7:00 AM - 8:00 PM
- Sunday: 8:00 AM - 8:00 PM
It is advisable to check their official website or call the provided number for the most up-to-date information on operating hours, specific wash offerings, and membership terms.
For residents of Lansing, Kansas, and the surrounding areas, Club Car Wash at 380 W Eisenhower Rd stands as a highly accessible and feature-rich option for keeping vehicles clean. Its prime location on a major road ensures convenience for daily commutes and quick detours. The wide array of express wash packages, coupled with the highly beneficial Unlimited Wash Club® membership, offers significant value and flexibility for regular car care. The inclusion of free powerful vacuums and other interior cleaning amenities further enhances the overall appeal, making it a comprehensive solution for maintaining your vehicle's appearance.
While the majority of experiences are likely positive, potential customers should be aware of the occasional reported issues regarding damage claims and membership cancellations. However, for those seeking a fast, modern, and convenient car wash experience with the option for unlimited washes, Club Car Wash in Lansing remains a suitable and popular choice. Its commitment to advanced technology and customer-focused amenities positions it as a go-to spot for keeping your car sparkling clean in Kansas.
Listing Information Signals
Use the completed fields as a starting point, then verify anything that could affect your trip, appointment, or cost.
This is not a guarantee or endorsement. It is a quick view of which public listing details are available enough to help you compare this business with nearby options.
380 W Eisenhower Rd, Lansing, KS 66043, USA
Map coordinates are available for route planning.
Phone number is available.
8:00 AM - 8:00 PM today
10 photos available.
334 public review signals available.
12 nearby alternatives shown for comparison.
The main listing fields are present, but hours, services, prices, appointments, and availability can still change.
What to compare before choosing
A useful listing should help you decide the next step, not just show a name and address.
Service Fit Checklist
Use these checks to decide whether this listing is worth calling, booking, or comparing with another option.
Ask whether they offer the specific wash, interior cleaning, detailing, hand wash, or package level you need.
Mention heavy dirt, pet hair, stains, oversized vehicles, ceramic coating, or specialty surfaces before you arrive.
Confirm wait time, appointment needs, weather limits, and whether the service can be completed the same day.
Clarify exterior, interior, wheels, vacuuming, waxing, drying, and any add-on charges before choosing a package.
- Remove personal items and valuables before interior service.
- Ask whether they need access to the trunk, child seats, mats, or cargo area.
- Take photos of existing scratches or damage if you are buying a deeper detail.
- Confirm drying, pickup, and aftercare guidance if wax, coating, or shampoo is involved.
Questions to Ask Before You Go
These prompts turn the listing into a practical call, booking, or route-check plan.
- Do they handle the exact car wash need, vehicle type, timing, and service scope you have?
- When you call, ask about appointments, walk-ins, estimates, and current wait times.
- Are the listed hours current for today, holidays, and the service you need?
- Does the business website show current services, booking rules, prices, or preparation notes?
- Do recent reviews mention the same service need you have, or should you compare another nearby option?
Send a correction so this listing can be reviewed for future visitors.
Update this listingReview data sourcesBusiness Hours
Timezone: America/Chicago
- Monday 7:00 AM - 8:00 PM
- Tuesday 7:00 AM - 8:00 PM
- Wednesday 7:00 AM - 8:00 PM
- Thursday 7:00 AM - 8:00 PM
- Friday 7:00 AM - 8:00 PM
- Saturday 7:00 AM - 8:00 PM
- Sunday 8:00 AM - 8:00 PM
Services
Service information may be incomplete or change over time. Confirm current service scope directly.
Car Wash
- Auto detailing
- Auto interior vacuuming
- Car waxing
- Polishing
- Scratch removal
- Vacuuming
- Bug Prep
- Car Mats
- Car Wash Club
- Ceramic X3
- Express Car Wash
- Floor Mat
- Free Towels
- Free Vacuums
- Hot Wax
- Interior Cleaning
- Normal Car Wash
- Premium Washes
- Spot Free Rinse
- Underbody Blast
- Unlimited Club
- Vehicle Washed
- Water Spots
- Wheel Blasters
- Wheel Brightener
Shop Features
Feature data comes from public listing details and should be confirmed before visiting.
Amenities
- Car vacuum
- Free vacuums
- Membership
- Towels
Payments
- Credit cards
- Debit cards
Photos
Photos help confirm location, storefront, service environment, and listing completeness.










Location
Use the map to compare distance and nearby alternatives before deciding where to go.
Club Car Wash
380 W Eisenhower Rd, Lansing, KS 66043, USA
Reviews
Use public reviews as one signal. Read several reviews and confirm details directly when the decision matters.
vacuumstowelsvehiclediscountkidsmilitarymatswindshieldrefundtip
Rating 5Rating 4Rating 3Rating 2Rating 1My niece came by the carwash earlier yesterday. The attendant operating the power washer noticed he was taking paint off the bumper as he was power washing the bumper. He pointed at the camera and continued to keep power washing. He told my niece what had happened. She asked why you didn't stop. He said it's on the camera. She filed a claim. The one in charge tried to download play the issue and admitted they have the video. I told her to ask when would be a good time to review the video together. There response is we can not give you a copy of the video. No one asked for a copy of the video. Only to sit down and review it together. They continued to down play this and avoid taking any responsibility for there action.
June 11 - Mike Lands LandsI just called to cancel a membership for my father who passed away 2 months ago and just saw the recurring charge on his credit card statement. Customer service cancelled the service, but would not refund his unused fees for this month or last. They didn't even say "Sorry for your loss." Maybe they provide a good car wash, but they are lacking in empathy, compassion, and doing the right thing.
April 08 - Erik H CaylorAfter a couple months started chipping my clear coat around my door handles and on my badges on my truck, went up and showed them and was told to make a claim and it wasn't even a couple hours later it was denied saying they were at zero fault. Their blowers blew off my trailer mirrors and was told they didn't have them or couldn't find them, My wife lost her rear wiper and they said she was beat on that and it also started taking off the Chrome plate off her Wheels and they told her since her car was older they are 7 years old They couldn't make a claim. Seems like they're full of excuses and won't take responsibility when it was their fault. And after reading some of the reviews of club car wash looks like they had multiple issues. Wow way to go for them👏. CLUB CAR WASH IS NOT A GOOD PLACE TO DO BUSINESS.If I could give zero Stars I would please all beware
December 28 - Jeremy HurstCan't say enough about Club Car. Wash all of the employees I've dealt with at all the locations. I've been to have been fantastic. It's very inexpensive to join. I drive Uber so I like to keep my car nice and clean and it's a terrific facility. I always stop and throw my spare. Change in the car into the tip jar. And they seem to really appreciate it.
December 13 - Jim StallingsNovember 9 around 6:55 Lansing KS location, I pull into the wash bay a young boy and a young girl barely even throw soap on my truck rushing me through as fast as they could cause they wanted to go home, I pull back around to the front wash bay entrance and show them two big bird poop eye level on my hood what they had missed. They were like it’s no big deal we can just wipe it off with a towel but our wash bay is now closed for the evening or Have a nice day is this type of service what I’m paying monthly for little kids not Monitor or supervise I had asked to speak to one guess what not available. So I called the corporate office and still waiting for someone to get back in touch with me. I want my truck washed right the first time, please investigate this matter and roll the cameras back you will see for yourself and ask yourself is this the type of service y'all want to put for the customers?
November 10 - Shawn Burgin
Questions About This Listing
These answers explain the current listing data and what users should verify.
Is this page a recommendation for Club Car Wash?
No. This page organizes available public listing data so you can compare contact details, hours, location, photos, reviews, and nearby alternatives. It is not a guarantee, certification, or endorsement.
Should I rely on the hours and service details shown here?
Treat them as a starting point. Hours, prices, appointment rules, and service availability can change, so confirm important details directly with the business before you visit.
How can outdated information be corrected?
Use the update listing link on this page to report outdated contact details, hours, address information, or removal requests for review.
What should I ask before choosing this car wash listing?
Ask whether the business handles your exact need, whether appointments or estimates are required, what is included, and how current wait times or availability look.
Why compare nearby alternatives?
Nearby listings may have clearer contact details, more complete photos, better hours data, or reviews that better match your service need. Comparing a few options reduces the chance of relying on one incomplete signal.
Nearby Car Wash Alternatives
Compare nearby listings before choosing. More complete listings may make it easier to verify details.
- The phone, hours, photos, or website information is missing or unclear.
- You need a faster appointment, a specific service, or a clearer estimate policy.
- Reviews or photos do not clearly match the service you are planning to request.
Classic Carwash South4.0 (311 reviews)900 Eisenhower Rd, Leavenworth, KS 66048, USA
Olympic-Car Wash4.0 (380 reviews)3107 S 4th St, Leavenworth, KS 66048, USA
Cowboy Express Car Wash4.0 (69 reviews)501 Metropolitan Ave, Leavenworth, KS 66048, USA
Classic Carwash North4.0 (184 reviews)1225 Metropolitan Ave, Leavenworth, KS 66048, USA
PRO CAR WASH PLATTE CITY4.0 (15 reviews)1303 Plaza Ct, Platte City, MO 64079, USA
GO Car Wash3.0 (99 reviews)2500 Running Horse Rd, Platte City, MO 64079, USA
Ward's Car Wash3.0 (210 reviews)10215 Leavenworth Rd, Kansas City, KS 66109, USA
Tidal Wave Auto Spa | Car Wash4.0 (331 reviews)10760 Parallel Pkwy, Kansas City, KS 66109, USA
GO Car Wash3.0 (359 reviews)9801 Troup Ave, Kansas City, KS 66109, USA
Porter Buggy Bath3.0 (196 reviews)399 N 130th St, Bonner Springs, KS 66012, USA
GO Car Wash4.0 (214 reviews)13015 Commercial Dr, Bonner Springs, KS 66012, USA
GO Car Wash4.0 (389 reviews)8717 NW 63rd St, Parkville, MO 64152, USA
Find and compare
Before you contact this listing
Treat this page as a starting point, then confirm the details that matter for your vehicle and timing.
Quick decision checklist
Current data snapshot
Service paths
Listings with more signals
Speeder's Car Wash2020 Burlington St, Kansas City, MO 64116, USA Many public reviews | Photos available
White Bridge Auto Wash212 White Bridge Pike, Nashville, TN 37209, USA Many public reviews | Photos available
Delta Sonic Car Wash and Oil Change1780 N Aurora Rd, Naperville, IL 60563, USA Many public reviews | Photos available Helpful guides
Undercarriage Wash: When Your Car Actually Needs OneTree Sap on Car Paint: Remove It Without Spreading ItHow to Vacuum Under Car Seats Without Damaging WiringShould You Wash a Car With Chipped Paint or Loose Trim?Useful search paths
Browse by state
Data and updates
Business details can change. Confirm hours, service scope, prices, and availability directly with the provider.




