Club Car Wash Overview
Use this section to understand what information is available before you compare, call, or visit.
For vehicle owners in Ballwin, Missouri, maintaining a clean and well-kept car is more than just a matter of pride; it's about protecting your investment from the elements and enjoying a more pleasant driving experience. From the dust and pollen of Missouri springs to the salt and grime of our winters, your car faces a lot. Finding a car wash that delivers consistent quality, convenience, and excellent value is essential. That’s where Club Car Wash, located right here in Ballwin, stands out as a premier choice for local drivers.
Club Car Wash is designed to provide a fast, efficient, and exceptionally thorough car cleaning experience. We understand that your time is valuable, which is why our express model focuses on getting your vehicle sparkling clean without a lengthy wait. Our state-of-the-art equipment and high-quality cleaning solutions are engineered to deliver a superior wash every time, ensuring your car emerges looking its best. We believe that a clean car contributes to a clear mind and a more enjoyable journey, and we strive to make that accessible for every customer.
Beyond just the wash itself, Club Car Wash is committed to offering a comprehensive car care solution. We go the extra mile with complimentary amenities that empower you to put the finishing touches on your vehicle's cleanliness, both inside and out. This dedication to a complete customer experience, combined with our focus on efficiency and quality, is what makes Club Car Wash a trusted name for vehicle owners across Missouri, including right here in Ballwin. We're not just washing cars; we're helping you maintain your pride and joy.
Club Car Wash is conveniently located at 110 Enchanted Pkwy, Ballwin, MO 63021. This strategic position offers excellent accessibility for residents throughout Ballwin and the wider West St. Louis County area. Whether you're commuting to work, running errands in the local shopping districts, or simply driving through the community, our car wash is easy to get to. The facility's design is engineered for smooth traffic flow, with clearly marked lanes for entry and exit, minimizing wait times and ensuring a hassle-free experience even during peak hours.
Being situated on Enchanted Parkway places Club Car Wash in a central and highly visible location within the Ballwin community. This accessibility is a significant advantage for busy individuals and families who value convenience and efficiency in their daily routines. Our aim is to be a consistent and reliable resource for all your car cleaning needs, making it simple to keep your vehicle looking great without having to go out of your way. We are proud to be a part of the Ballwin landscape, serving our neighbors with top-tier car wash services.
Express Exterior Washes: Fast and effective automatic washes designed to clean the exterior of your vehicle, removing common dirt, dust, and grime efficiently.
Multiple Wash Packages: Club Car Wash offers a variety of wash packages, from basic washes to premium options that include advanced features for enhanced cleaning and protection.
Unlimited Wash Club Memberships: A core offering, these monthly memberships allow for unlimited washes at any Club Car Wash location, providing exceptional value for frequent users. Various membership tiers (e.g., Elite Express Pass) are available, offering different levels of wash features.
Ceramic Protection: Higher-tier wash packages often include ceramic-infused products that create a durable, hydrophobic layer on your vehicle's paint, enhancing shine and providing long-lasting protection against environmental elements.
Tire Shine Application: Professional tire shine application for a glossy finish that complements a clean vehicle exterior.
Wheel Cleaning: Specialized processes and products to effectively clean brake dust and road grime from your wheels, restoring their luster.
Undercarriage Wash: Essential for removing corrosive road salt, dirt, and debris from the underside of your vehicle, protecting vital components, especially important after Missouri winters.
Bug Prep/Remover: Targeted treatments to effectively remove stubborn bug residue from your vehicle's front end, preventing paint damage.
Rain Repellent Application: A specialized treatment designed to improve visibility during wet weather by repelling water from your windshield and other glass surfaces.
Spot-Free Rinse: Utilizes purified water to ensure a streak-free and spot-free finish, eliminating water spots as your car dries.
Elite Express Pass and Unlimited Washes: The cornerstone of Club Car Wash's appeal is its Unlimited Wash Club, particularly the Elite Express Pass, which provides frequent washers with incredible value and the convenience of washing their car as often as they like. This system emphasizes speed and consistent cleanliness.
Exceptional Drying Capabilities: As noted by customer reviews, Club Car Wash is recognized for its effective drying system, which is often a challenge for express drive-through washes, ensuring cars come out thoroughly dried.
Complimentary Floor Mat Washing: A standout amenity, customers often receive complimentary washing of their floor mats, adding significant value and contributing to a more complete interior cleanliness without extra charge.
Free Self-Serve Vacuums: Abundant, powerful self-serve vacuums are available for customer use at no additional cost after a wash, allowing for a thorough interior cleaning. While generally well-maintained, it's worth noting that during extremely busy periods, individual vacuum stations might experience temporary issues.
Free Towels and Window Cleaner: Customers are provided with complimentary towels and Windex (or similar window cleaner) to put the finishing touches on their vehicle's interior and exterior glass, highlighting a commitment to a complete cleaning experience.
Accommodating Staff: Customer feedback often highlights the accommodating and helpful nature of the staff, contributing to a positive overall experience.
Advanced Cleaning Technology: The use of advanced wash tunnel equipment and high-quality cleaning solutions, including ceramic applications, ensures a superior and long-lasting clean.
Multiple Convenient Locations: As a "Club" model, members typically have access to all Club Car Wash locations, offering widespread convenience across various regions, including multiple spots throughout Missouri.
Address: 110 Enchanted Pkwy, Ballwin, MO 63021, USA
Phone: (833) 416-9975
Mobile Phone: +1 833-416-9975
For direct inquiries regarding services, membership plans, or to address any specific concerns, customers are encouraged to use the provided phone numbers. Club Car Wash maintains a robust customer service presence, and these centralized numbers are typically well-staffed to assist with a wide range of questions, from technical issues to membership details. Additionally, their official website often provides comprehensive FAQs, service explanations, and opportunities to manage your Unlimited Wash Club membership online. While individual locations may have staff available, for broader support or issues like those experienced during extremely busy periods (e.g., clogged vacuums or residue from high-speed washing), utilizing the main contact line is often the most effective approach.
For the residents of Ballwin, Missouri, Club Car Wash at 110 Enchanted Pkwy emerges as an exceptionally suitable and highly recommended option for vehicle cleaning and maintenance. Its core strength lies in its commitment to delivering a high-quality, efficient express wash experience, perfectly suited for the busy lifestyles common in our community. The advanced washing technology ensures that your car receives a thorough clean, from removing everyday dust to tackling the tough grime that Missouri roads can inflict.
The accessibility of its location on Enchanted Parkway is a significant advantage, making it a convenient stop for Ballwin locals, whether they’re on their way to work, running errands, or simply looking to refresh their vehicle. This ease of access, combined with the quick turnaround time of the express wash, means that keeping your car clean no longer has to be a time-consuming chore.
However, the true standout feature and the primary reason for its suitability for locals is the unparalleled value and convenience offered by the Unlimited Wash Club memberships, particularly the Elite Express Pass. For a single monthly fee, Ballwin residents can wash their vehicles as often as they desire at any Club Car Wash location. This is incredibly beneficial for maintaining a consistently clean car, especially given Missouri’s diverse weather patterns that can quickly dirty a vehicle. The inclusion of premium features like Ceramic Protection and effective drying capabilities within these packages further enhances the value, protecting your car's finish and keeping it looking showroom-ready.
Beyond the wash itself, the complimentary amenities truly set Club Car Wash apart. The provision of free, powerful self-serve vacuums, free towels, and even free floor mat washing demonstrates a comprehensive approach to car care that goes beyond just the exterior. This attention to detail allows locals to achieve a complete clean, inside and out, all in one convenient stop, without additional costs for essential detailing. The accommodating staff, as frequently noted in reviews, also contributes to a positive and welcoming atmosphere.
While some experiences during extremely busy periods might involve minor inconveniences like residual soap or temporarily unavailable vacuums, these appear to be exceptions rather than the norm. The overwhelmingly positive feedback regarding the wash quality, drying effectiveness, and the value of the unlimited pass underscores its reliability.
In conclusion, Club Car Wash in Ballwin is more than just a place to get your car washed; it's a comprehensive car care partner for the local community. Its blend of cutting-edge technology, exceptional value through unlimited memberships, and thoughtful complimentary amenities makes it an ideal choice for Ballwin residents looking for a convenient, high-quality, and cost-effective way to keep their vehicles sparkling clean throughout the year.
Listing Information Signals
Use the completed fields as a starting point, then verify anything that could affect your trip, appointment, or cost.
This is not a guarantee or endorsement. It is a quick view of which public listing details are available enough to help you compare this business with nearby options.
110 Enchanted Pkwy, Ballwin, MO 63021, USA
Map coordinates are available for route planning.
Phone number is available.
8:00 AM - 8:00 PM today
10 photos available.
273 public review signals available.
12 nearby alternatives shown for comparison.
The main listing fields are present, but hours, services, prices, appointments, and availability can still change.
What to compare before choosing
A useful listing should help you decide the next step, not just show a name and address.
Service Fit Checklist
Use these checks to decide whether this listing is worth calling, booking, or comparing with another option.
Ask whether they offer the specific wash, interior cleaning, detailing, hand wash, or package level you need.
Mention heavy dirt, pet hair, stains, oversized vehicles, ceramic coating, or specialty surfaces before you arrive.
Confirm wait time, appointment needs, weather limits, and whether the service can be completed the same day.
Clarify exterior, interior, wheels, vacuuming, waxing, drying, and any add-on charges before choosing a package.
- Remove personal items and valuables before interior service.
- Ask whether they need access to the trunk, child seats, mats, or cargo area.
- Take photos of existing scratches or damage if you are buying a deeper detail.
- Confirm drying, pickup, and aftercare guidance if wax, coating, or shampoo is involved.
Questions to Ask Before You Go
These prompts turn the listing into a practical call, booking, or route-check plan.
- Do they handle the exact car wash need, vehicle type, timing, and service scope you have?
- When you call, ask about appointments, walk-ins, estimates, and current wait times.
- Are the listed hours current for today, holidays, and the service you need?
- Does the business website show current services, booking rules, prices, or preparation notes?
- Do recent reviews mention the same service need you have, or should you compare another nearby option?
Send a correction so this listing can be reviewed for future visitors.
Update this listingReview data sourcesBusiness Hours
Timezone: America/Chicago
- Monday 7:00 AM - 8:00 PM
- Tuesday 7:00 AM - 8:00 PM
- Wednesday 7:00 AM - 8:00 PM
- Thursday 7:00 AM - 8:00 PM
- Friday 7:00 AM - 8:00 PM
- Saturday 7:00 AM - 8:00 PM
- Sunday 8:00 AM - 8:00 PM
Services
Service information may be incomplete or change over time. Confirm current service scope directly.
Car Wash
- Auto detailing
- Car waxing
- Polishing
- Vacuuming
- Basic Wash
- Bug Prep
- Carnauba Hot Wax
- Elite Wash $18.00
Presoak Wheel Brightener Spot Free Tire Shine Under Body Wheel Blasters Triple Polish Foaminator Bath Blowers Carnuba Hot Wax
- Express Tunnel Car Wash
- Free Towel
- Free Towels
- Free Vacuums
- Health Insurance
- MVP Wash $25.00
Presoak Wheel Brightener Spot Free Under Body Wheel Blasters Tire Shine Triple Polish Foaminator Bath Blowers Club Ceramic
- Membership Services
- Mvp Wash
- Pre-Soak
- Rookie Wash $10.00
Presoak Wheel Brightener Spot Free Clear Coat Blowers
- Single Wash
- Spot Free Rinse
- Triple Polish
- Underbody Blast
- Unlimited Washes
- VIP Wash $14.00
Presoak Wheel Brightener Spot Free Under Body Wheel Blasters Triple Polish Foaminator Bath Blowers
- Vip Wash
- Wash Packages
- Wheel Blasters
Shop Features
Feature data comes from public listing details and should be confirmed before visiting.
Amenities
- Car vacuum
- Free vacuums
- Membership
- Towels
- Restroom
Payments
- Credit cards
- Debit cards
- Credit cards
Photos
Photos help confirm location, storefront, service environment, and listing completeness.










Location
Use the map to compare distance and nearby alternatives before deciding where to go.
Club Car Wash
110 Enchanted Pkwy, Ballwin, MO 63021, USA
Reviews
Use public reviews as one signal. Read several reviews and confirm details directly when the decision matters.
vacuumstowelspricevehiclematsdryingmicrofiberpaydrive throughwheels
Rating 5Rating 4Rating 3Rating 2Rating 1We use the Elite Express Pass. It does a great job washing and even drying well, which is unusual for a drive thru car wash. Staff was accommodating. They even washed my floor mats, no charge. Free towels, vacuum and Windex.
June 16 - Steve P222Normally, this car wash is spectacular. Today and the last time I came it’s after we’ve had snow in bad weather. The place is packed. They’re running the cars through at a very high rate of speed. The result is my car was covered with soap when I came off the end of the line, there was water all over the hood wasn’t blown off well and the top things off at station 13 and 14 both of the vacuums were clogged up and didn’t work.Don’t come here on a very busy day!
March 16 - R DicksonSmooth enough until a part of my car was knocked loose. Service attendant was helpful in filing a claim with their insurance. Their insurance wouldn't cover it because the part appeared to be loose according to the cameras as I entered the wash, so that's fair.Service attendant helped fix a broken vaccum too.Good service, so-so facilities.
April 06 - Jacob EnglandJust had the worst car wash ever. I understand it’s the first nice day but half my car wasn’t even touched (like not even wet) and I paid for the $20 wash. Only giving 2 stars because the staff was kind and courteous. The only option given was to wait in line again, after I had already waited in line for over 20 minutes. Decided to cut my losses and not push it. Would not recommend this location.
February 22 - Hannah HydeCleans the car really good. Most of all it gets the wheels really clean more than most other car washes
July 12 - BigRyo Xclusive
Questions About This Listing
These answers explain the current listing data and what users should verify.
Is this page a recommendation for Club Car Wash?
No. This page organizes available public listing data so you can compare contact details, hours, location, photos, reviews, and nearby alternatives. It is not a guarantee, certification, or endorsement.
Should I rely on the hours and service details shown here?
Treat them as a starting point. Hours, prices, appointment rules, and service availability can change, so confirm important details directly with the business before you visit.
How can outdated information be corrected?
Use the update listing link on this page to report outdated contact details, hours, address information, or removal requests for review.
What should I ask before choosing this car wash listing?
Ask whether the business handles your exact need, whether appointments or estimates are required, what is included, and how current wait times or availability look.
Why compare nearby alternatives?
Nearby listings may have clearer contact details, more complete photos, better hours data, or reviews that better match your service need. Comparing a few options reduces the chance of relying on one incomplete signal.
Nearby Car Wash Alternatives
Compare nearby listings before choosing. More complete listings may make it easier to verify details.
- The phone, hours, photos, or website information is missing or unclear.
- You need a faster appointment, a specific service, or a clearer estimate policy.
- Reviews or photos do not clearly match the service you are planning to request.
Speedy Car Wash4.0 (234 reviews)13894 Manchester Rd, Manchester, MO 63011, USA
St. Louis Car Wash3.0 (130 reviews)13650 Big Bend Rd, Valley Park, MO 63088, USA
Tommy's Expressu00ae Car Wash4.0 (108 reviews)14918 Manchester Rd, Ballwin, MO 63011, USA
Waterway Carwash4.0 (186 reviews)388 Lamp and Lantern Village, Town and Country, MO 63017, USA
Circle K | Car Wash2.0 (9 reviews)12804 Manchester Rd, Des Peres, MO 63131, USA
Brite WorX Car Washery4.0 (179 reviews)14905 Clayton Rd, Chesterfield, MO 63017, USA
Club Car Wash4.0 (195 reviews)1912 Bowles Ave, Fenton, MO 63026, USA
Club Car Wash4.0 (463 reviews)1029 Majestic Dr, Fenton, MO 63026, USA
Tidal Wave Wash Center4.0 (191 reviews)127 Clarkson Rd, Ellisville, MO 63011, USA
St. Louis Car Wash3.0 (107 reviews)1535 Smizer Mill Rd, Fenton, MO 63026, USA
Waterway Carwash3.0 (362 reviews)10850 Manchester Rd, Kirkwood, MO 63122, USA
Plaza Self Service Car Wash4.0 (238 reviews)16109 Manchester Rd, Ellisville, MO 63011, USA
Find and compare
Before you contact this listing
Treat this page as a starting point, then confirm the details that matter for your vehicle and timing.
Quick decision checklist
Current data snapshot
Service paths
Listings with more signals
Speeder's Car Wash2020 Burlington St, Kansas City, MO 64116, USA Many public reviews | Photos available
White Bridge Auto Wash212 White Bridge Pike, Nashville, TN 37209, USA Many public reviews | Photos available
Delta Sonic Car Wash and Oil Change1780 N Aurora Rd, Naperville, IL 60563, USA Many public reviews | Photos available Helpful guides
Undercarriage Wash: When Your Car Actually Needs OneTree Sap on Car Paint: Remove It Without Spreading ItHow to Vacuum Under Car Seats Without Damaging WiringShould You Wash a Car With Chipped Paint or Loose Trim?Useful search paths
Browse by state
Data and updates
Business details can change. Confirm hours, service scope, prices, and availability directly with the provider.




